Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_003121.1 | Gene: | SRI / 6717 | HGNCID: | 11292 | Length: | 198 | Species: | Homo sapiens |
Alignment Length: | 203 | Identity: | 75/203 - (36%) |
---|---|---|---|
Similarity: | 113/203 - (55%) | Gaps: | 23/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSY------GQGYNPYAQPGGGYAPPPG--AFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQA 57
Fly 58 AL----VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIE 118
Fly 119 EQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTI 183
Fly 184 TIGFEDFL 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 49/139 (35%) |
EFh | 39..92 | CDD:238008 | 21/56 (38%) | ||
EFh | 105..159 | CDD:298682 | 20/53 (38%) | ||
SRI | NP_003121.1 | EFh_PEF_sorcin | 34..198 | CDD:320062 | 60/162 (37%) |
EF-hand motif | 34..62 | CDD:320062 | 9/28 (32%) | ||
EF-hand motif | 74..103 | CDD:320062 | 13/28 (46%) | ||
EF-hand motif | 104..133 | CDD:320062 | 12/28 (43%) | ||
EF-hand motif | 140..167 | CDD:320062 | 7/28 (25%) | ||
EF-hand motif | 169..197 | CDD:320062 | 10/24 (42%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54126 | |
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100410 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.730 |