DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and SRI

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_003121.1 Gene:SRI / 6717 HGNCID:11292 Length:198 Species:Homo sapiens


Alignment Length:203 Identity:75/203 - (36%)
Similarity:113/203 - (55%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSY------GQGYNPYAQPGGGYAPPPG--AFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQA 57
            |:|      |.||.|     |||...||  |||   .|.......:|:.| ..:.|:|:|.|||.
Human     1 MAYPGHPGAGGGYYP-----GGYGGAPGGPAFP---GQTQDPLYGYFAAV-AGQDGQIDADELQR 56

  Fly    58 AL----VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIE 118
            .|    :.|....|:...|:||:||.|.|.|||:...||::|:..:|.|.|.|.::|.|.||.::
Human    57 CLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVD 121

  Fly   119 EQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTI 183
            .|||.:|.|.||||.||:.:|.:.|:....|  :::.|.:|..||:::..|::||:|||.|.|.:
Human   122 PQELQKALTTMGFRLSPQAVNSIAKRYSTNG--KITFDDYIACCVKLRALTDSFRRRDTAQQGVV 184

  Fly   184 TIGFEDFL 191
            ...::||:
Human   185 NFPYDDFI 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 49/139 (35%)
EFh 39..92 CDD:238008 21/56 (38%)
EFh 105..159 CDD:298682 20/53 (38%)
SRINP_003121.1 EFh_PEF_sorcin 34..198 CDD:320062 60/162 (37%)
EF-hand motif 34..62 CDD:320062 9/28 (32%)
EF-hand motif 74..103 CDD:320062 13/28 (46%)
EF-hand motif 104..133 CDD:320062 12/28 (43%)
EF-hand motif 140..167 CDD:320062 7/28 (25%)
EF-hand motif 169..197 CDD:320062 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.