DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Capn12

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001104277.1 Gene:Capn12 / 60594 MGIID:1891369 Length:720 Species:Mus musculus


Alignment Length:148 Identity:34/148 - (22%)
Similarity:61/148 - (41%) Gaps:17/148 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AQQWFSMVDRDRSGKINASELQA----ALVNGRGD-----HFSDNACKLMISMFDNDASGTIDIY 90
            ||.:..:...:.  ::||.:||.    ||...|.:     ......|:.::..|..  ...:.::
Mouse   554 AQLFLELAGEEE--ELNALQLQTLISIALEPARANTRTPGEIGLRTCEQLVQCFGR--GQRLSLH 614

  Fly    91 EFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSV 155
            .|::|:.::..|...|..:|:|:||.:...||..|.|..||..:.:....|..:. ......|..
Mouse   615 HFQELWGHLMSWQATFDKFDEDASGTMNSCELRLALTAAGFHLNNQLTQSLTSRY-RDSRLRVDF 678

  Fly   156 DQFIVLCVQVQRFTEAFR 173
            ::| |.|  ..|.|..||
Mouse   679 ERF-VCC--AARLTCIFR 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 29/135 (21%)
EFh 39..92 CDD:238008 9/61 (15%)
EFh 105..159 CDD:298682 13/53 (25%)
Capn12NP_001104277.1 Peptidase_C2 46..339 CDD:279042
Domain III 342..541
Calpain_III 352..531 CDD:238132
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..415
Domain IV 542..720 34/148 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836664
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.