Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009293787.1 | Gene: | si:dkeyp-50d11.2 / 565825 | ZFINID: | ZDB-GENE-091113-22 | Length: | 704 | Species: | Danio rerio |
Alignment Length: | 230 | Identity: | 45/230 - (19%) |
---|---|---|---|
Similarity: | 93/230 - (40%) | Gaps: | 48/230 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 YAQPGGGYAPPPGAFPPQN---------AQVSPQAQQWFSMVDRD-------------------- 45
Fly 46 --RSG---KINASELQAAL-------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNY 98
Fly 99 INQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLV---KKSDPQGHKEVSVDQFIV 160
Fly 161 LCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 35/179 (20%) |
EFh | 39..92 | CDD:238008 | 13/84 (15%) | ||
EFh | 105..159 | CDD:298682 | 15/56 (27%) | ||
si:dkeyp-50d11.2 | XP_009293787.1 | Peptidase_C2 | 51..347 | CDD:279042 | |
Calpain_III | 361..507 | CDD:279416 | 7/29 (24%) | ||
EF1B | 500..563 | CDD:294128 | 7/62 (11%) | ||
EFh | 580..630 | CDD:298682 | 14/49 (29%) | ||
EFh | 612..667 | CDD:238008 | 16/58 (28%) | ||
EF-hand_7 | 613..698 | CDD:290234 | 20/88 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |