DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and si:dkeyp-50d11.2

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_009293787.1 Gene:si:dkeyp-50d11.2 / 565825 ZFINID:ZDB-GENE-091113-22 Length:704 Species:Danio rerio


Alignment Length:230 Identity:45/230 - (19%)
Similarity:93/230 - (40%) Gaps:48/230 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YAQPGGGYAPPPGAFPPQN---------AQVSPQAQQWFSMVDRD-------------------- 45
            ::.|.|.|...|..|.||.         ::.:..:|:....:..|                    
Zfish   477 FSLPAGEYIIVPSTFEPQKEGDFVLRVFSEKATDSQELDDEISADVPEEPVLQESDIDEGFKALF 541

  Fly    46 --RSG---KINASELQAAL-------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNY 98
              .:|   :||.::|:..|       .:.:.|.|....|:.||::.|...:|.:.:.:|..|:..
Zfish   542 AKLAGPEMEINVAKLEMILNRVVSKHKDIKTDGFGKETCRGMINLMDTTGTGKLGLTDFHVLWEK 606

  Fly    99 INQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLV---KKSDPQGHKEVSVDQFIV 160
            ..::|.||:.:|.|.||.:...|:..|....||:.:......::   .|||    ..|..|.|:.
Zfish   607 FKRYLAVFREFDIDKSGTMSSYEMRLALESAGFKLTNNLFQLIILRYAKSD----LNVDFDNFVA 667

  Fly   161 LCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            ..::::...:.|:..|..::|.::..|..::|:.:
Zfish   668 CLIRLETMFKTFKTLDADEDGLVSFSFAQWITLTM 702

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 35/179 (20%)
EFh 39..92 CDD:238008 13/84 (15%)
EFh 105..159 CDD:298682 15/56 (27%)
si:dkeyp-50d11.2XP_009293787.1 Peptidase_C2 51..347 CDD:279042
Calpain_III 361..507 CDD:279416 7/29 (24%)
EF1B 500..563 CDD:294128 7/62 (11%)
EFh 580..630 CDD:298682 14/49 (29%)
EFh 612..667 CDD:238008 16/58 (28%)
EF-hand_7 613..698 CDD:290234 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.