DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn2b

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001018177.1 Gene:capn2b / 563053 ZFINID:ZDB-GENE-050522-84 Length:696 Species:Danio rerio


Alignment Length:131 Identity:33/131 - (25%)
Similarity:71/131 - (54%) Gaps:5/131 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGF 131
            |:.:.|::|:::.|:..:|.:.:.||..|:..:.::|::||..|.||||.|...||..|..:.||
Zfish   568 FTLDTCRVMVNLMDDSGNGKLGLGEFATLWKKVQRYLEIFKHNDLDSSGTISTPELRMALKEAGF 632

  Fly   132 RFSPEFINFLVKKSDPQGHKEVSV--DQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVA 194
            ..:......:|.:   ...|::::  |.|:...::::....||::.|..::|.|.:.|..:|.:.
Zfish   633 CLNNTLFQLMVAR---YAEKDMTLLFDNFVSCLMRLEMMFRAFKRLDPHKSGFIELNFNQWLNLT 694

  Fly   195 I 195
            :
Zfish   695 M 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 26/96 (27%)
EFh 39..92 CDD:238008 5/24 (21%)
EFh 105..159 CDD:298682 16/55 (29%)
capn2bNP_001018177.1 Peptidase_C2 46..339 CDD:279042
Calpain_III 354..503 CDD:279416
EFh 573..628 CDD:238008 19/54 (35%)
FRQ1 601..>686 CDD:227455 23/87 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.