| Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036524.1 | Gene: | PEF1 / 553115 | HGNCID: | 30009 | Length: | 284 | Species: | Homo sapiens |
| Alignment Length: | 202 | Identity: | 87/202 - (43%) |
|---|---|---|---|
| Similarity: | 115/202 - (56%) | Gaps: | 20/202 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 9 PY--AQPGGGYAPPP--------------GAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQA 57
Fly 58 ALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQEL 122
Fly 123 TQAFTQMGFRFSPEFINFLVKKSDPQ-GHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIG 186
Fly 187 FEDFLTV 193 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 59/136 (43%) |
| EFh | 39..92 | CDD:238008 | 26/52 (50%) | ||
| EFh | 105..159 | CDD:298682 | 21/54 (39%) | ||
| PEF1 | NP_036524.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..111 | 10/30 (33%) | |
| 9 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P. /evidence=ECO:0000305 | 21..109 | 9/28 (32%) | |||
| EFh_PEF_peflin | 118..283 | CDD:320059 | 73/161 (45%) | ||
| EF-hand motif | 118..147 | CDD:320059 | 15/28 (54%) | ||
| EF-hand motif | 155..184 | CDD:320059 | 13/28 (46%) | ||
| EF-hand motif | 185..215 | CDD:320059 | 15/29 (52%) | ||
| Required for interaction with PDCD6. /evidence=ECO:0000269|PubMed:11883899 | 204..284 | 33/75 (44%) | |||
| EF-hand motif | 221..251 | CDD:320059 | 9/29 (31%) | ||
| EF-hand motif | 252..283 | CDD:320059 | 14/27 (52%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I10510 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 1 | 1.000 | - | - | H56569 | |
| Inparanoid | 1 | 1.050 | 163 | 1.000 | Inparanoid score | I4214 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG54126 | |
| OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
| OrthoInspector | 1 | 1.000 | - | - | oto88700 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_100410 | |
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2225 |
| SonicParanoid | 1 | 1.000 | - | - | X1327 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 14 | 13.770 | |||||