DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capns1a

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001017899.2 Gene:capns1a / 550598 ZFINID:ZDB-GENE-030113-3 Length:216 Species:Danio rerio


Alignment Length:189 Identity:54/189 - (28%)
Similarity:99/189 - (52%) Gaps:14/189 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PPPGAFPPQNAQVSPQA-QQWFSMVDRDRSG---KINASELQAAL---VNGRG----DHFSDNAC 72
            |||...|...|..:..| :|.|..|....:|   :::.:||...|   ::..|    |.|:..:|
Zfish    28 PPPPRRPLAYAVSNESAEEQQFRKVFNQLAGDDMEVSPTELMNILNKIISKHGDLKTDGFTIESC 92

  Fly    73 KLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEF 137
            :.|:::.|:|::|.:..:||:.|:|.|.:|..::||||:|.||.|...||..||...||..:.:.
Zfish    93 RSMVAVMDSDSTGKLGFHEFKHLWNNIKKWQGIYKTYDRDHSGTIGADELPAAFRAAGFPLTDQL 157

  Fly   138 INFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            ...:::: ||..|:  :..|.:|...|::.....||:..|...:|||.:..:::|.:.:
Zfish   158 FQMIIRRYSDESGN--MDFDNYIGCLVRLDAMCHAFKTLDKDNDGTIKVNVQEWLQLTM 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 42/147 (29%)
EFh 39..92 CDD:238008 14/62 (23%)
EFh 105..159 CDD:298682 18/54 (33%)
capns1aNP_001017899.2 EFh 92..142 CDD:298682 19/49 (39%)
EFh 125..175 CDD:238008 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.