Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016667.1 | Gene: | sri / 549421 | XenbaseID: | XB-GENE-952117 | Length: | 195 | Species: | Xenopus tropicalis |
Alignment Length: | 199 | Identity: | 75/199 - (37%) |
---|---|---|---|
Similarity: | 105/199 - (52%) | Gaps: | 18/199 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSYGQGYNPYAQPG----GGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL-- 59
Fly 60 --VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQEL 122
Fly 123 TQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGF 187
Fly 188 EDFL 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 52/139 (37%) |
EFh | 39..92 | CDD:238008 | 21/56 (38%) | ||
EFh | 105..159 | CDD:298682 | 21/53 (40%) | ||
sri | NP_001016667.1 | EFh_PEF_sorcin | 31..195 | CDD:320062 | 62/163 (38%) |
EF-hand motif | 31..59 | CDD:320062 | 10/29 (34%) | ||
EF-hand motif | 71..100 | CDD:320062 | 12/28 (43%) | ||
EF-hand motif | 101..131 | CDD:320062 | 14/29 (48%) | ||
EF-hand motif | 137..164 | CDD:320062 | 8/28 (29%) | ||
EF-hand motif | 165..195 | CDD:320062 | 9/25 (36%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |