DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and sri

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001016667.1 Gene:sri / 549421 XenbaseID:XB-GENE-952117 Length:195 Species:Xenopus tropicalis


Alignment Length:199 Identity:75/199 - (37%)
Similarity:105/199 - (52%) Gaps:18/199 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYGQGYNPYAQPG----GGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL-- 59
            |:|     |..|||    |||...||. |....|..|....:.|:..:|  |:|:|.|||..|  
 Frog     1 MAY-----PGQQPGGYYQGGYGGAPGG-PAYGQQQDPMYGYFASIAGQD--GQIDADELQRCLTQ 57

  Fly    60 --VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQEL 122
              ::|....||...|:|||:|.|.|.||.:...||::|...||.|.|.|.|||.|.||.:|..||
 Frog    58 AGLSGGYKPFSLETCRLMIAMLDRDMSGKMGFNEFKELGMVINGWRQHFMTYDGDRSGTVEGHEL 122

  Fly   123 TQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGF 187
            ..|...||:|.||:.:|.:.|:....|  .:|.|.:|..||:::..|:.||:||..|.|.:...:
 Frog   123 HAALGAMGYRLSPQALNNIAKRYSTNG--RISFDDYITCCVKLRALTDMFRRRDVSQQGVVNFQY 185

  Fly   188 EDFL 191
            :||:
 Frog   186 DDFI 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 52/139 (37%)
EFh 39..92 CDD:238008 21/56 (38%)
EFh 105..159 CDD:298682 21/53 (40%)
sriNP_001016667.1 EFh_PEF_sorcin 31..195 CDD:320062 62/163 (38%)
EF-hand motif 31..59 CDD:320062 10/29 (34%)
EF-hand motif 71..100 CDD:320062 12/28 (43%)
EF-hand motif 101..131 CDD:320062 14/29 (48%)
EF-hand motif 137..164 CDD:320062 8/28 (29%)
EF-hand motif 165..195 CDD:320062 9/25 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.