DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capns2

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001016161.1 Gene:capns2 / 548915 XenbaseID:XB-GENE-5764367 Length:234 Species:Xenopus tropicalis


Alignment Length:201 Identity:57/201 - (28%)
Similarity:107/201 - (53%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YNPYAQPGGGYAPPPGAFP----PQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL-------V 60
            |||  ||     |||.:.|    ...::.:.|.::.||.:..| ..:::|:||...|       .
 Frog    42 YNP--QP-----PPPRSHPSVIQSNESEETRQFRRLFSQLAGD-DMEVSATELMGILNKVIAKHQ 98

  Fly    61 NGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQA 125
            :.:.|.||.::|:.|:::.|:|::|.:...||:.|::.|.:|..|:|.||.|.||.|...||..|
 Frog    99 DLKTDGFSADSCRSMVAVMDSDSTGKLGFEEFKYLWDNIKKWQGVYKRYDTDRSGTIGRNELPGA 163

  Fly   126 FTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFED 189
            ||..||:.:.:..:.:::: ||.:|  ::..|.:|...|::.....||:..|...:|.|.:..::
 Frog   164 FTAAGFQLNGQLYDMIIRRYSDEKG--DMDFDNYICCLVRLDAMFRAFKTLDKDGDGQIKVTIQE 226

  Fly   190 FLTVAI 195
            :|.:.:
 Frog   227 WLQLTM 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 41/143 (29%)
EFh 39..92 CDD:238008 15/59 (25%)
EFh 105..159 CDD:298682 19/54 (35%)
capns2NP_001016161.1 EFh_PEF_CPNS1_2 66..234 CDD:320063 48/170 (28%)
EF-hand motif 66..94 CDD:320063 8/28 (29%)
EF-hand motif 108..138 CDD:320063 8/29 (28%)
EF-hand motif 139..169 CDD:320063 14/29 (48%)
EF-hand motif 175..203 CDD:320063 6/29 (21%)
EF-hand motif 204..234 CDD:320063 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.