Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016161.1 | Gene: | capns2 / 548915 | XenbaseID: | XB-GENE-5764367 | Length: | 234 | Species: | Xenopus tropicalis |
Alignment Length: | 201 | Identity: | 57/201 - (28%) |
---|---|---|---|
Similarity: | 107/201 - (53%) | Gaps: | 22/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YNPYAQPGGGYAPPPGAFP----PQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL-------V 60
Fly 61 NGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQA 125
Fly 126 FTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFED 189
Fly 190 FLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 41/143 (29%) |
EFh | 39..92 | CDD:238008 | 15/59 (25%) | ||
EFh | 105..159 | CDD:298682 | 19/54 (35%) | ||
capns2 | NP_001016161.1 | EFh_PEF_CPNS1_2 | 66..234 | CDD:320063 | 48/170 (28%) |
EF-hand motif | 66..94 | CDD:320063 | 8/28 (29%) | ||
EF-hand motif | 108..138 | CDD:320063 | 8/29 (28%) | ||
EF-hand motif | 139..169 | CDD:320063 | 14/29 (48%) | ||
EF-hand motif | 175..203 | CDD:320063 | 6/29 (21%) | ||
EF-hand motif | 204..234 | CDD:320063 | 6/29 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |