DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn2a

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001013519.1 Gene:capn2a / 541374 ZFINID:ZDB-GENE-050320-69 Length:698 Species:Danio rerio


Alignment Length:225 Identity:50/225 - (22%)
Similarity:95/225 - (42%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGGGYAPPPGAFPPQN---------AQVSPQAQQW---------FSMVDRDR--SG--------- 48
            |.|.|...|..|.|..         ::...:.||.         ..||..:.  ||         
Zfish   476 PPGEYLIVPSTFDPHKNGDFCVRVFSEKQSEMQQCDDPIEANVDDEMVSEEEVDSGFRGLFTKLA 540

  Fly    49 ----KINASELQ-------AALVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQW 102
                :|:||||:       |...:.:.|.||.:.|::|:::.|...:|.:.:.||..|:..|.::
Zfish   541 GDDMEISASELRTIFNKIVAKRTDIKTDGFSLDTCRVMVNLMDESGNGKLGLTEFATLWKKIQKY 605

  Fly   103 LQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSV--DQFIVLCVQV 165
            |.::|..|.|.||.:...|:..|..:.||..:......|..:   .|..::::  |.|:...:::
Zfish   606 LGIYKKNDMDGSGCMSTPEMRMALKEAGFSLNDCIHQSLAAR---YGDADMTIDFDNFVSCVMRL 667

  Fly   166 QRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            :...:.|::.|...:|.|.:.|..:|:.|:
Zfish   668 EMMFKVFKRMDIDHSGFIELDFFQWLSFAM 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 38/177 (21%)
EFh 39..92 CDD:238008 17/74 (23%)
EFh 105..159 CDD:298682 12/55 (22%)
capn2aNP_001013519.1 Peptidase_C2 46..339 CDD:279042
Calpain_III 354..505 CDD:279416 6/28 (21%)
EF-hand_8 542..601 CDD:290545 16/58 (28%)
EFh 575..630 CDD:298682 16/54 (30%)
FRQ1 602..>694 CDD:227455 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.