DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn13

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001008025.1 Gene:capn13 / 493387 XenbaseID:XB-GENE-6045506 Length:763 Species:Xenopus tropicalis


Alignment Length:154 Identity:38/154 - (24%)
Similarity:73/154 - (47%) Gaps:12/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DRSGKINASELQAAL----------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYI 99
            ::|.::.|.:||..|          ..|||| |:.:||:.::.:.|.:|:|.:.:.||.:|:..:
 Frog   604 NKSSELYAEQLQRLLNEVIIKDQTFAGGRGD-FTLDACRGILMLMDLNANGRLSLQEFGRLWKRL 667

  Fly   100 NQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQ 164
            |....:|::.|.:.:|.|:...|.:|....|...|...||.:|.:......| :|...|:...::
 Frog   668 NMCKDMFRSIDGNQTGFIDASGLKKAVQLAGLPISNALINVMVLRYANSSEK-LSFADFVCCMIR 731

  Fly   165 VQRFTEAFRQRDTQQNGTITIGFE 188
            ::..|:.|:.......|....|.|
 Frog   732 LETVTKVFKNLSKDGRGVYLSGEE 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 33/126 (26%)
EFh 39..92 CDD:238008 15/56 (27%)
EFh 105..159 CDD:298682 13/53 (25%)
capn13NP_001008025.1 Peptidase_C2 48..341 CDD:366222
Calpain_III 364..497 CDD:366446
EFh_PEF_CAPN13_14 595..763 CDD:320070 38/154 (25%)
EF-hand motif 595..622 CDD:320070 5/17 (29%)
EF-hand motif 639..668 CDD:320070 8/28 (29%)
EF-hand motif 669..699 CDD:320070 6/29 (21%)
EF-hand motif 705..733 CDD:320070 6/28 (21%)
EF-hand motif 735..763 CDD:320070 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.