Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005585.1 | Gene: | gca / 449543 | ZFINID: | ZDB-GENE-040930-3 | Length: | 205 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 67/202 - (33%) |
---|---|---|---|
Similarity: | 110/202 - (54%) | Gaps: | 15/202 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 GYNPY-AQPG----GGY-APPPGAFPPQNAQVSPQAQQW--FSMVDRDRSGKINASELQAAL--- 59
Fly 60 -VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELT 123
Fly 124 QAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFE 188
Fly 189 DFLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 41/141 (29%) |
EFh | 39..92 | CDD:238008 | 16/56 (29%) | ||
EFh | 105..159 | CDD:298682 | 17/53 (32%) | ||
gca | NP_001005585.1 | EFh | 52..106 | CDD:298682 | 17/53 (32%) |
EFh | 82..132 | CDD:298682 | 18/49 (37%) | ||
EFh | 116..168 | CDD:298682 | 17/53 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG54126 | |
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000697 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100410 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.730 |