DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and gca

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001005585.1 Gene:gca / 449543 ZFINID:ZDB-GENE-040930-3 Length:205 Species:Danio rerio


Alignment Length:202 Identity:67/202 - (33%)
Similarity:110/202 - (54%) Gaps:15/202 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GYNPY-AQPG----GGY-APPPGAFPPQNAQVSPQAQQW--FSMVDRDRSGKINASELQAAL--- 59
            |||.| |.||    ||| ..|.|.:|...:....|...|  |:.: ..:.|:::|.|||..|   
Zfish     5 GYNNYGAMPGVPAAGGYPGQPYGGYPGSFSAAPAQDPMWGYFTAI-AGQDGEVDAEELQRCLTQT 68

  Fly    60 -VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELT 123
             ::|....||...|::||::.|.|.:|.:...||::|:..:|.|.|.|...|:|.||.:|..|::
Zfish    69 GISGSYTPFSLETCRIMIALLDRDYTGKMGFNEFKELFGVLNGWKQNFMMVDRDHSGTVEPYEMS 133

  Fly   124 QAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFE 188
            |:...||:|.||..::.:||:....|  ::..|.::..||:::..|:.||:|||.|.|.:...::
Zfish   134 QSIANMGYRVSPRVLDAIVKRYSRSG--KIYFDDYVACCVKLKALTDHFRRRDTMQQGMVNFQYD 196

  Fly   189 DFLTVAI 195
            ||:...|
Zfish   197 DFILCTI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 41/141 (29%)
EFh 39..92 CDD:238008 16/56 (29%)
EFh 105..159 CDD:298682 17/53 (32%)
gcaNP_001005585.1 EFh 52..106 CDD:298682 17/53 (32%)
EFh 82..132 CDD:298682 18/49 (37%)
EFh 116..168 CDD:298682 17/53 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.