DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn9

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001003501.1 Gene:capn9 / 445107 ZFINID:ZDB-GENE-010724-2 Length:688 Species:Danio rerio


Alignment Length:185 Identity:47/185 - (25%)
Similarity:86/185 - (46%) Gaps:12/185 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PPGAFPPQNAQVSPQA-QQWFSMVDRDRSGKINASELQAALVNGRG-------DHFSDNACKLMI 76
            ||...||:......:. ::.|..| ......|:|.|||..|.|..|       |..|.|.|..:|
Zfish   505 PPKPNPPEEETDEEKGLRKLFEQV-AGPDNVISARELQHVLNNVLGRRKEVKFDGLSLNTCISII 568

  Fly    77 SMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFL 141
            ::.|.|.||.::..||:..::.:.:|:.:|.:||.|.||.:...||..|....|.:.:...:..|
Zfish   569 NLMDVDGSGMMEFSEFKVFWDKLKKWIMLFLSYDVDRSGTMSSYELRSALNAAGMKLNNRILQLL 633

  Fly   142 -VKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
             ::.:|.:  .|:..|.::...|:::.....|:..|.|:.|.:::....||.:.:
Zfish   634 GLRFADEK--LEIDFDDYLTCIVRLENMFRIFQALDAQKKGEVSLNMHQFLLLTM 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 37/144 (26%)
EFh 39..92 CDD:238008 19/59 (32%)
EFh 105..159 CDD:298682 14/54 (26%)
capn9NP_001003501.1 Peptidase_C2 41..333 CDD:279042
Calpain_III 347..489 CDD:279416
EFh 564..618 CDD:298682 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.