DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn2l

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001003485.1 Gene:capn2l / 445091 ZFINID:ZDB-GENE-050417-341 Length:700 Species:Danio rerio


Alignment Length:226 Identity:51/226 - (22%)
Similarity:93/226 - (41%) Gaps:41/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YAQPGGGYAPPPGAFPPQN-----AQVSPQAQQWFSMVDRDRSGK-------------------- 49
            :..|.|.|...|..|.|..     .:|..:.|..|..:|.....|                    
Zfish   475 FCLPPGEYLIVPSTFEPNKDGDFCVRVFSEKQAEFQELDDPVESKVAEIEITEGDIDSRFKKLFG 539

  Fly    50 --------INASELQAALVNG-------RGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYI 99
                    |:|.|||..|.|.       :.|.||...|:.|:::.|.|.:|.:.:.||:.|:..|
Zfish   540 QLAGADCEISAFELQKILNNVIAKRKEIKTDGFSLETCRNMVNLLDKDGTGKLGLLEFKILWTKI 604

  Fly   100 NQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQ 164
            ..::.|:...|:|.||.:...|:.:|..:.||..:......||.:.. :.:..:..|.|:...::
Zfish   605 ELFVDVYSKNDKDQSGTMSSMEMREAVEKAGFSLNNALHQILVARYS-ESNLTIDFDNFVACLIR 668

  Fly   165 VQRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            ::...:||:..|..:|||:.:...::|.|::
Zfish   669 LECMFKAFKVLDKDKNGTVELNMIEWLNVSM 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 38/175 (22%)
EFh 39..92 CDD:238008 18/87 (21%)
EFh 105..159 CDD:298682 12/53 (23%)
capn2lNP_001003485.1 Peptidase_C2 46..342 CDD:279042
Calpain_III 356..507 CDD:279416 7/31 (23%)
EFh 577..631 CDD:298682 15/53 (28%)
FRQ1 604..>695 CDD:227455 20/91 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.