DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and zgc:85932

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_998104.1 Gene:zgc:85932 / 405875 ZFINID:ZDB-GENE-040426-2460 Length:671 Species:Danio rerio


Alignment Length:120 Identity:28/120 - (23%)
Similarity:59/120 - (49%) Gaps:1/120 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPE 136
            ||..:.:.|:...|.:|:.||:.|::.:.:|..:|.|:|::.:..::..|::.|.:..|.:.. |
Zfish   547 CKSFVVLMDSQGMGRLDLTEFQALWDKLRKWTSIFITFDKNKNQALDYLEISPALSAAGIKVD-E 610

  Fly   137 FINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL 191
            ||..|:.....:....:|...|:.|.:::......|:..|....|.|::....||
Zfish   611 FILQLISLRYTEPDMTLSFPGFLFLLMKLDCMMRKFQSFDVTGTGMISVNCRQFL 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 21/89 (24%)
EFh 39..92 CDD:238008 5/19 (26%)
EFh 105..159 CDD:298682 11/53 (21%)
zgc:85932NP_998104.1 Peptidase_C2 46..330 CDD:279042
Calpain_III 345..471 CDD:279416
FRQ1 572..>660 CDD:227455 18/88 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.