DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and sri

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_005157918.1 Gene:sri / 393344 ZFINID:ZDB-GENE-040426-1356 Length:190 Species:Danio rerio


Alignment Length:202 Identity:77/202 - (38%)
Similarity:120/202 - (59%) Gaps:19/202 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSYGQGYNPYAQP-GGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAAL--VNG 62
            |:| |||.  |.| .|||   ||.||.|  |..|....:.::..:|  |:|:|.||||.|  .|.
Zfish     1 MNY-QGYG--APPAAGGY---PGGFPGQ--QQDPLYGYFTAIAGQD--GQISAEELQACLTQANF 55

  Fly    63 RGDH--FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQA 125
            .|.:  |:...|:|||||.|.|.|.::...||::|:..:|.|.|.|.:.|:|.||.::.||:.||
Zfish    56 SGGYRPFNLETCRLMISMLDRDMSYSMGFNEFKELWAVLNGWKQHFMSIDRDMSGTVDPQEMNQA 120

  Fly   126 FTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDF 190
            .:.||:|.||:.:|.::|:...||  :::.|.::..||:::..|:.||:||..|.|..|..::||
Zfish   121 ISSMGYRLSPQAMNSIIKRYSSQG--KITFDDYVACCVKLRSLTDVFRKRDQAQQGMATFQYDDF 183

  Fly   191 L--TVAI 195
            :  |::|
Zfish   184 IHCTMSI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 49/139 (35%)
EFh 39..92 CDD:238008 21/56 (38%)
EFh 105..159 CDD:298682 19/53 (36%)
sriXP_005157918.1 EFh 37..92 CDD:298682 24/56 (43%)
EFh 67..122 CDD:238008 24/54 (44%)
EFh 101..153 CDD:238008 19/53 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.730

Return to query results.
Submit another query.