DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and CAPN8

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001137434.1 Gene:CAPN8 / 388743 HGNCID:1485 Length:703 Species:Homo sapiens


Alignment Length:192 Identity:40/192 - (20%)
Similarity:89/192 - (46%) Gaps:27/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GGGYAPPPGAFPPQNAQVSPQAQQWFSMVDR--DRSGKINASELQAAL-------VNGRGDHFSD 69
            |..|.|.|       ::|..:..|:..:.::  .:..:|.|:.|:..|       .:.:.|.|:.
Human   520 GNPYEPHP-------SEVDQEDDQFRRLFEKLAGKDSEITANALKILLNEAFSKRTDIKFDGFNI 577

  Fly    70 NACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFS 134
            |.|:.|||:.|::.:||:...||:.|:..|.::|:::...|.:.||.|:..|:..|..:.||..:
Human   578 NTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEMRTALRKAGFTLN 642

  Fly   135 PEF-----INFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL 191
            .:.     :.:...|..      ::.|.|:...::::...:.|...|..::|.:.:...::|
Human   643 SQVQQTIALRYACSKLG------INFDSFVACMIRLETLFKLFSLLDEDKDGMVQLSLAEWL 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 32/149 (21%)
EFh 39..92 CDD:238008 14/61 (23%)
EFh 105..159 CDD:298682 10/58 (17%)
CAPN8NP_001137434.1 Peptidase_C2 46..342 CDD:279042
Calpain_III 356..509 CDD:279416
Domain III 356..379
EFh 580..635 CDD:238008 18/54 (33%)
PTZ00183 618..>692 CDD:185503 14/79 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.