DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and CalpA

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster


Alignment Length:131 Identity:39/131 - (29%)
Similarity:73/131 - (55%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGF 131
            ||.:.|:.|::|.|.|.||.:...|||.|.:.|.:|..:||.||.:::|.:...:|.:|....|:
  Fly   714 FSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGY 778

  Fly   132 RFSPEFINFLVKKSDPQGHK------EVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDF 190
            ..:...:|.|       ||:      :::.|.||:..|:::.:.:.|::|||::|.|.|...|::
  Fly   779 HLNNRVLNVL-------GHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEW 836

  Fly   191 L 191
            :
  Fly   837 I 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 30/100 (30%)
EFh 39..92 CDD:238008 9/24 (38%)
EFh 105..159 CDD:298682 13/59 (22%)
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:279042
Calpain_III 418..565 CDD:279416
EFh 719..765 CDD:238008 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.