DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pef and CalpA

DIOPT Version :10

Sequence 1:NP_610592.1 Gene:Pef / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001286613.1 Gene:CalpA / 37232 FlyBaseID:FBgn0012051 Length:843 Species:Drosophila melanogaster


Alignment Length:131 Identity:39/131 - (29%)
Similarity:73/131 - (55%) Gaps:13/131 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGF 131
            ||.:.|:.|::|.|.|.||.:...|||.|.:.|.:|..:||.||.:::|.:...:|.:|....|:
  Fly   714 FSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAIFKVYDVENTGRVSGFQLREALNSAGY 778

  Fly   132 RFSPEFINFLVKKSDPQGHK------EVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDF 190
            ..:...:|.|       ||:      :::.|.||:..|:::.:.:.|::|||::|.|.|...|::
  Fly   779 HLNNRVLNVL-------GHRYGSRDGKIAFDDFIMCAVKIKTYIDIFKERDTEKNETATFTLEEW 836

  Fly   191 L 191
            :
  Fly   837 I 837

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PefNP_610592.1 EFh_PEF_peflin 34..198 CDD:320059 39/131 (30%)
EF-hand motif 34..63 CDD:320059
EF-hand motif 71..100 CDD:320059 11/28 (39%)
EF-hand motif 101..131 CDD:320059 8/29 (28%)
EF-hand motif 137..166 CDD:320059 8/34 (24%)
EF-hand motif 167..198 CDD:320059 8/25 (32%)
CalpANP_001286613.1 Peptidase_C2 104..400 CDD:459889
Calpain_III 416..569 CDD:238132
EFh_PEF_CalpA_B 600..843 CDD:320071 39/131 (30%)
EF-hand motif 600..627 CDD:320071
EF-hand motif 717..747 CDD:320071 11/29 (38%)
EF-hand motif 748..778 CDD:320071 8/29 (28%)
EF-hand motif 784..812 CDD:320071 8/34 (24%)
EF-hand motif 813..843 CDD:320071 8/25 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.