DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Capn13

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001020304.1 Gene:Capn13 / 362701 RGDID:1562682 Length:668 Species:Rattus norvegicus


Alignment Length:139 Identity:34/139 - (24%)
Similarity:67/139 - (48%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 DRSGKINASELQAA-----LVNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQ 104
            |:...|:||:||:.     |....||.||.:.|:.::::.|...:|.:|..||.:|.:.:.....
  Rat   510 DQGLDIDASQLQSLLNQEYLTGPPGDTFSLDQCQSIMALMDLKVNGRLDREEFARLQSRLIHCQH 574

  Fly   105 VFKTYDQDSSGHIEEQELTQAFTQ----MGFRFSPEFINFL-VKKSDPQGHKEVSVDQFIVLCVQ 164
            ||: :.|.|.|.:...:|.:....    .|...|.|.::.: ::.||..|  .:|....:...::
  Rat   575 VFQ-HIQRSQGVLRSSDLWEVIESTDFLSGVLLSKELLSLMTLRYSDSSG--RLSFPSLVCFLIR 636

  Fly   165 VQRFTEAFR 173
            ::..::|||
  Rat   637 LETMSKAFR 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 31/126 (25%)
EFh 39..92 CDD:238008 15/51 (29%)
EFh 105..159 CDD:298682 13/58 (22%)
Capn13NP_001020304.1 Peptidase_C2 35..329 CDD:279042
Calpain_III 345..477 CDD:294111
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340365
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.