Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001231009.1 | Gene: | capn8 / 337730 | ZFINID: | ZDB-GENE-050522-279 | Length: | 701 | Species: | Danio rerio |
Alignment Length: | 225 | Identity: | 51/225 - (22%) |
---|---|---|---|
Similarity: | 92/225 - (40%) | Gaps: | 44/225 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 PGGGYAPPPGAFPP----------------------------------QNAQVSPQAQQWFSMVD 43
Fly 44 RDRSGKINASELQAAL--------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYIN 100
Fly 101 QWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQV 165
Fly 166 QRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 40/177 (23%) |
EFh | 39..92 | CDD:238008 | 19/60 (32%) | ||
EFh | 105..159 | CDD:298682 | 13/53 (25%) | ||
capn8 | NP_001231009.1 | Peptidase_C2 | 46..342 | CDD:279042 | |
Calpain_III | 356..507 | CDD:279416 | 6/28 (21%) | ||
EFh | 578..633 | CDD:238008 | 20/54 (37%) | ||
EFh | 607..691 | CDD:298682 | 19/84 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |