DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn8

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001231009.1 Gene:capn8 / 337730 ZFINID:ZDB-GENE-050522-279 Length:701 Species:Danio rerio


Alignment Length:225 Identity:51/225 - (22%)
Similarity:92/225 - (40%) Gaps:44/225 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGGGYAPPPGAFPP----------------------------------QNAQVSPQAQQWFSMVD 43
            |.|.|...|..|.|                                  ....:.|..::.||.|.
Zfish   478 PPGEYIIIPSTFEPHRKGSFILRVFAEKEADASQIGTEISADVKKHFISEKDIDPHFKRLFSQVA 542

  Fly    44 RDRSGKINASELQAAL--------VNGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYIN 100
            ...| :::..|||..|        .|.:.|.||...|:.:||:.|.|.||.:.:.||..|:..|.
Zfish   543 GSDS-EVSVLELQQILNTVVSKRKSNVKTDGFSLETCRHIISLLDKDGSGKLGLLEFHTLWMKIQ 606

  Fly   101 QWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQV 165
            ::|::||..|.|:||.:...|:..|..:.||:.:.:.:..|:.:...|.: .:..|.|:...:::
Zfish   607 KYLEIFKHRDTDNSGTMSSLEMRDAVKEAGFQLNNDVLEVLIARYANQEY-AIDFDSFVSCLIRL 670

  Fly   166 QRFTEAFRQRDTQQNGTITIGFEDFLTVAI 195
            :...:.|:..|.:..|.|.:....:|.:|:
Zfish   671 ELLFKMFQLFDKKNTGKIELDILQWLCLAL 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 40/177 (23%)
EFh 39..92 CDD:238008 19/60 (32%)
EFh 105..159 CDD:298682 13/53 (25%)
capn8NP_001231009.1 Peptidase_C2 46..342 CDD:279042
Calpain_III 356..507 CDD:279416 6/28 (21%)
EFh 578..633 CDD:238008 20/54 (37%)
EFh 607..691 CDD:298682 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.