DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Capn12

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_038967508.1 Gene:Capn12 / 308476 RGDID:1307341 Length:766 Species:Rattus norvegicus


Alignment Length:151 Identity:36/151 - (23%)
Similarity:64/151 - (42%) Gaps:19/151 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AQQWFSMVDRDRSGKINASELQA----ALVNGRGD-----HFSDNACKLMISMFDNDASGTIDIY 90
            ||.:..:...:.  ::||.:||.    ||...|.:     ......|:.::..|..  ...:.:|
  Rat   553 AQLFLELAGEEE--ELNALQLQTLISIALEPARNNTRTSGEIGLRTCEQLVQCFGR--GQRLALY 613

  Fly    91 EFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSV 155
            .|::|:.::..|...|..:|:|:||.:...||..|.|..||..:.:....|..:   ..:..:.|
  Rat   614 HFQELWGHLLSWQATFDKFDEDASGTMNSCELRLALTAAGFHLNNQLTQALTSR---YRNSRLRV 675

  Fly   156 D-QFIVLCVQVQRFTEAFRQR 175
            | :..|.|  ..|.|..||:|
  Rat   676 DFEHFVCC--AARLTCIFRER 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 30/136 (22%)
EFh 39..92 CDD:238008 10/61 (16%)
EFh 105..159 CDD:298682 14/54 (26%)
Capn12XP_038967508.1 Peptidase_C2 46..339 CDD:395523
Calpain_III 352..530 CDD:238132
EFh_PEF 567..693 CDD:355382 32/132 (24%)
EF-hand motif 596..623 CDD:320054 5/28 (18%)
EF-hand motif 624..654 CDD:320054 10/29 (34%)
EF-hand motif 660..688 CDD:320054 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.