DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Pdcd6

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001100922.1 Gene:Pdcd6 / 308061 RGDID:1311239 Length:191 Species:Rattus norvegicus


Alignment Length:184 Identity:73/184 - (39%)
Similarity:111/184 - (60%) Gaps:6/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 QPGGGYAPPPGAFPPQNAQVSPQAQQW--FSMVDRDRSGKINASELQAALVNGRGDHFSDNACKL 74
            :||.|..|.|.|    .|.:..|:..|  |..||:||||.|:.:|||.||.||....|:....:.
  Rat     7 RPGPGAGPGPAA----GAALPDQSFLWNVFQRVDKDRSGVISDNELQQALSNGTWTPFNPVTVRS 67

  Fly    75 MISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFIN 139
            :|||||.:....::..||..::.||..|..||:|||:|:||.|::.||.||.:..|:|.|.:|.:
  Rat    68 IISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKHELKQALSGFGYRLSDQFHD 132

  Fly   140 FLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTV 193
            .|::|.|.||..:::.|.||..|:.:||.|:.||:.||.|:|.|.:.:|.:|::
  Rat   133 ILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSM 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 54/137 (39%)
EFh 39..92 CDD:238008 21/52 (40%)
EFh 105..159 CDD:298682 23/53 (43%)
Pdcd6NP_001100922.1 EFh_PEF_ALG-2 27..191 CDD:320058 65/160 (41%)
EF-hand motif 27..56 CDD:320058 15/28 (54%)
EF-hand motif 64..93 CDD:320058 8/28 (29%)
EF-hand motif 94..124 CDD:320058 14/29 (48%)
EF-hand motif 130..159 CDD:320058 10/28 (36%)
EF-hand motif 160..191 CDD:320058 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.