DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Pef1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001007652.1 Gene:Pef1 / 297900 RGDID:1359536 Length:283 Species:Rattus norvegicus


Alignment Length:194 Identity:83/194 - (42%)
Similarity:112/194 - (57%) Gaps:8/194 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YGQGY-NPY-AQPGGGYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNGRGD 65
            |||.: :|| .||.|.|.  .|..||   .|.|:|..||..||.|.||.|:..||:.||||....
  Rat    89 YGQAHPSPYGTQPPGPYG--QGGVPP---NVDPEAYSWFQSVDADHSGYISLKELKQALVNSNWS 148

  Fly    66 HFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFTQMG 130
            .|:|..|.:||:|||...:|.||:..|..|:.::.||..:|:.||:|.||.|...||.||.:|||
  Rat   149 SFNDETCLMMINMFDKTKTGRIDVVGFSALWKFLQQWKNLFQQYDRDHSGSISSTELQQALSQMG 213

  Fly   131 FRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFLTV 193
            :..||:|...||.: ........:.:|.||.:|.|:|..|||||::||...|.|.:.||||:|:
  Rat   214 YNLSPQFTQLLVSRYCTRSAIPAMQLDCFIKVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 55/136 (40%)
EFh 39..92 CDD:238008 24/52 (46%)
EFh 105..159 CDD:298682 20/54 (37%)
Pef1NP_001007652.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
9 X 9 AA approximate tandem repeat of [AP]-P-G-G-P-Y-G-G-P-P 21..108 9/20 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..114 12/29 (41%)
EF-hand_7 122..178 CDD:290234 25/55 (45%)
EFh 122..171 CDD:238008 22/48 (46%)
EF-hand_6 184..213 CDD:290141 14/28 (50%)
EF-hand_7 186..277 CDD:290234 38/90 (42%)
EFh 186..277 CDD:298682 38/90 (42%)
Required for interaction with PDCD6. /evidence=ECO:0000250|UniProtKB:Q9UBV8 203..283 32/75 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10901
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56569
Inparanoid 1 1.050 155 1.000 Inparanoid score I4226
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto95831
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.740

Return to query results.
Submit another query.