DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Gca

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_663498.1 Gene:Gca / 227960 MGIID:1918521 Length:220 Species:Mus musculus


Alignment Length:194 Identity:66/194 - (34%)
Similarity:104/194 - (53%) Gaps:15/194 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GQGYNPYAQPGGGYAPPPGAFPPQNAQVSPQAQQW--FSMVDRDRSGKINASELQAAL----VNG 62
            |.|.|.::   |||   ||.....::........|  |:.| ..:.|:::|.|||..|    ::|
Mouse    30 GAGPNMFS---GGY---PGYLGYSDSYSPADDSMWTYFTAV-AGQDGEVDAEELQRCLTQSGISG 87

  Fly    63 RGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFT 127
            ....||...|::||:|.|.|.:|.:...||::|:..:|.|.|.|.|.|||.||.:|..||:||..
Mouse    88 TYAPFSLETCRIMIAMLDRDYTGKMGFNEFKELWAALNAWKQNFMTIDQDQSGTVEHHELSQAIA 152

  Fly   128 QMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFEDFL 191
            .||:|.||:.:..:|::....|  .:..|.::..||:::..|:.||:||..|.|.:...:||||
Mouse   153 LMGYRLSPQTLAAIVRRYSKNG--RIFFDDYVACCVKLRALTDFFRRRDHLQQGIVNFMYEDFL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 45/141 (32%)
EFh 39..92 CDD:238008 18/56 (32%)
EFh 105..159 CDD:298682 20/53 (38%)
GcaNP_663498.1 EFh 67..122 CDD:238008 19/54 (35%)
EF-hand_7 67..120 CDD:290234 18/52 (35%)
EFh 97..152 CDD:298682 25/54 (46%)
EF-hand_7 128..183 CDD:290234 21/56 (38%)
EFh 131..183 CDD:298682 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100410
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.