DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and clpr-1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_493397.3 Gene:clpr-1 / 189180 WormBaseID:WBGene00012233 Length:252 Species:Caenorhabditis elegans


Alignment Length:137 Identity:34/137 - (24%)
Similarity:53/137 - (38%) Gaps:53/137 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SDNAC-------KLMISMFDNDASG-----TIDIY------EFEKLYNYINQ---WL-------- 103
            ||..|       ||:|       :|     .||.:      .||: |.|:.:   |:        
 Worm    16 SDRECDKLAKSLKLLI-------NGEWKVLKIDFHLPQKSNSFER-YAYMVKKQIWVAFIEKGFA 72

  Fly   104 QVFKTYDQDSSG--HIEEQELTQAFTQMGF--RFSP------EFI------NFLVKKSDPQGHKE 152
            ::.|:|::.|.|  .|..|:||.|.|...|  :|:.      |||      .|::..|.|...:|
 Worm    73 KIRKSYEKLSGGVAGIALQQLTGAMTFSVFMEKFNNDENRVWEFIQENRNSKFILTVSTPTIEEE 137

  Fly   153 VSVDQFI 159
            ....|.:
 Worm   138 SEKKQLL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 34/137 (25%)
EFh 39..92 CDD:238008 9/41 (22%)
EFh 105..159 CDD:298682 20/69 (29%)
clpr-1NP_493397.3 CysPc <28..229 CDD:381776 31/125 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.