powered by:
Protein Alignment CG17765 and clp-1
DIOPT Version :9
Sequence 1: | NP_610592.1 |
Gene: | CG17765 / 36111 |
FlyBaseID: | FBgn0033529 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498741.3 |
Gene: | clp-1 / 176122 |
WormBaseID: | WBGene00000542 |
Length: | 780 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 17/59 - (28%) |
Similarity: | 28/59 - (47%) |
Gaps: | 12/59 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 FRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNG--TITIGF 187
|..:|:| ...:..|||....|:....|.|| |:: :|:.:|:| .:.|||
Worm 656 FANNPQF-RVQLTDSDPDDDDELCTVIFAVL----QKY-----RRNLKQDGLDNVPIGF 704
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160158993 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.