DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and clp-1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_498741.3 Gene:clp-1 / 176122 WormBaseID:WBGene00000542 Length:780 Species:Caenorhabditis elegans


Alignment Length:59 Identity:17/59 - (28%)
Similarity:28/59 - (47%) Gaps:12/59 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 FRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNG--TITIGF 187
            |..:|:| ...:..|||....|:....|.||    |::     :|:.:|:|  .:.|||
 Worm   656 FANNPQF-RVQLTDSDPDDDDELCTVIFAVL----QKY-----RRNLKQDGLDNVPIGF 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 9/30 (30%)
EFh 39..92 CDD:238008
EFh 105..159 CDD:298682 7/27 (26%)
clp-1NP_498741.3 Peptidase_C2 317..609 CDD:279042
Calpain_III 631..772 CDD:279416 17/59 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.