DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and clp-3

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_493052.3 Gene:clp-3 / 173089 WormBaseID:WBGene00000544 Length:752 Species:Caenorhabditis elegans


Alignment Length:180 Identity:34/180 - (18%)
Similarity:58/180 - (32%) Gaps:75/180 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QAQQWF-SMVDRDRSGKIN-----------ASELQAALVNGRGDHF-------SDNACKLMISMF 79
            |:|||. :..:.:.|.:|.           .:.||..:      ||       |::.|.::.::|
 Worm   580 QSQQWIQASFEGEWSSRIGTAGGCDDHDTFCTNLQYEI------HFRATDSYDSNHKCTIIAALF 638

  Fly    80 DNDASGTID-----------IYEF--------------------EKLYN-----------YINQW 102
            ..:....:.           :||.                    .||:.           .:..:
 Worm   639 QKNRDHCVYKGLELFLIGLLVYEMPGPNEKVTPEMVKSQTPIADSKLFKDSREANIRFTVPLGHY 703

  Fly   103 LQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFIN--FLVKKSDPQGH 150
            :.|..|||.|..|..    |.:.||.:.|..:....|  .|:.|||  ||
 Worm   704 VIVPSTYDPDQDGEF----LLRIFTNVDFDKTHALSNGIGLICKSD--GH 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 34/180 (19%)
EFh 39..92 CDD:238008 10/82 (12%)
EFh 105..159 CDD:298682 17/48 (35%)
clp-3NP_493052.3 MDN1 <5..136 CDD:227596
CysPc 254..559 CDD:238004
Calpain_III 582..732 CDD:238132 26/159 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.