DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and Capns1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_033925.2 Gene:Capns1 / 12336 MGIID:88266 Length:268 Species:Mus musculus


Alignment Length:201 Identity:53/201 - (26%)
Similarity:98/201 - (48%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YNPYAQPGGGYAPPPGA-FPPQNAQVSPQAQQW---FSMVDRDRSGKINASELQAAL-------V 60
            |||  :|     |||.: :....|..|.:.:|:   |..:..| ..:::|:||...|       .
Mouse    76 YNP--EP-----PPPRSHYSNIEANESEEVRQFRKLFVQLAGD-DMEVSATELMNILNKVVTRHP 132

  Fly    61 NGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQA 125
            :.:.|.|..:.|:.|:::.|:|.:|.:...||:.|:|.|.:|..::|.:|.|.||.|...||..|
Mouse   133 DLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKRFDTDRSGTIGSHELPGA 197

  Fly   126 FTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFED 189
            |...||..:....:.:::: :|..|:  :..|.||...|::.....||:..|....|.|.:..::
Mouse   198 FEAAGFHLNEHLYSMIIRRYADESGN--MDFDNFISCLVRLDAMFRAFKSLDKNGTGQIQVNIQE 260

  Fly   190 FLTVAI 195
            :|.:.:
Mouse   261 WLQLTM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 39/146 (27%)
EFh 39..92 CDD:238008 13/59 (22%)
EFh 105..159 CDD:298682 15/54 (28%)
Capns1NP_033925.2 EFh_PEF_CPNS1_2 100..268 CDD:320063 44/170 (26%)
EF-hand motif 100..128 CDD:320063 7/28 (25%)
EF-hand motif 142..172 CDD:320063 9/29 (31%)
EF-hand motif 173..203 CDD:320063 11/29 (38%)
EF-hand motif 209..237 CDD:320063 6/29 (21%)
EF-hand motif 238..268 CDD:320063 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0037
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.