Sequence 1: | NP_610592.1 | Gene: | CG17765 / 36111 | FlyBaseID: | FBgn0033529 | Length: | 199 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033925.2 | Gene: | Capns1 / 12336 | MGIID: | 88266 | Length: | 268 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 53/201 - (26%) |
---|---|---|---|
Similarity: | 98/201 - (48%) | Gaps: | 22/201 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 YNPYAQPGGGYAPPPGA-FPPQNAQVSPQAQQW---FSMVDRDRSGKINASELQAAL-------V 60
Fly 61 NGRGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQA 125
Fly 126 FTQMGFRFSPEFINFLVKK-SDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFED 189
Fly 190 FLTVAI 195 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17765 | NP_610592.1 | FRQ1 | 26..162 | CDD:227455 | 39/146 (27%) |
EFh | 39..92 | CDD:238008 | 13/59 (22%) | ||
EFh | 105..159 | CDD:298682 | 15/54 (28%) | ||
Capns1 | NP_033925.2 | EFh_PEF_CPNS1_2 | 100..268 | CDD:320063 | 44/170 (26%) |
EF-hand motif | 100..128 | CDD:320063 | 7/28 (25%) | ||
EF-hand motif | 142..172 | CDD:320063 | 9/29 (31%) | ||
EF-hand motif | 173..203 | CDD:320063 | 11/29 (38%) | ||
EF-hand motif | 209..237 | CDD:320063 | 6/29 (21%) | ||
EF-hand motif | 238..268 | CDD:320063 | 6/29 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0037 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1330600at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |