DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and capn10l

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_031758129.1 Gene:capn10l / 100497805 XenbaseID:XB-GENE-5889689 Length:708 Species:Xenopus tropicalis


Alignment Length:162 Identity:40/162 - (24%)
Similarity:72/162 - (44%) Gaps:14/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RSGKINASELQA----ALVNGRGDH----FSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQW 102
            :.||:|:.:||.    .:..|...|    ||..|.:.|::..|...:|.:::..|.:|:.|:|.:
 Frog   551 QGGKMNSQDLQKFLNDVISKGFAPHGGIRFSTEASRSMLASMDFTCNGKLELEFFMRLWRYLNHF 615

  Fly   103 LQVFKTYDQDSSGHIEEQELTQAFTQMGFRFSPEFINFLVKKSDPQGHKEVSVDQFIVLCVQVQR 167
            ..:|...|.|.:|.|...||.:|....|...|.:.:..|:.:   .|..|:.::....||..| |
 Frog   616 KAIFTDVDVDQNGFIGLSELRKAAKSAGMAVSSDQLTILLLR---YGDYEMKLNFEDYLCCMV-R 676

  Fly   168 FTEAFR--QRDTQQNGTITIGFEDFLTVAIGC 197
            ...||:  |..|.....:.:....:|.:.:.|
 Frog   677 LKSAFKRFQMLTSDGKGVYLTEGKWLKIMMSC 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 30/123 (24%)
EFh 39..92 CDD:238008 13/53 (25%)
EFh 105..159 CDD:298682 13/53 (25%)
capn10lXP_031758129.1 Peptidase_C2 43..365 CDD:395523
Calpain_III 400..517 CDD:395848
EFh_PEF_CAPN13_14 541..708 CDD:320070 39/160 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.