DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17765 and pef1

DIOPT Version :9

Sequence 1:NP_610592.1 Gene:CG17765 / 36111 FlyBaseID:FBgn0033529 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_002938526.1 Gene:pef1 / 100144965 XenbaseID:XB-GENE-1013238 Length:283 Species:Xenopus tropicalis


Alignment Length:200 Identity:79/200 - (39%)
Similarity:115/200 - (57%) Gaps:21/200 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PYAQPGG-----------GYAPPPGAFPPQNAQVSPQAQQWFSMVDRDRSGKINASELQAALVNG 62
            ||:.||.           |...|.|..||   .|.|:|..||..||.|.||.|:..||:.||||.
 Frog    84 PYSVPGSTPYGNQQHGPYGQGAPTGNIPP---GVDPEAFSWFQTVDSDHSGYISLKELKQALVNS 145

  Fly    63 RGDHFSDNACKLMISMFDNDASGTIDIYEFEKLYNYINQWLQVFKTYDQDSSGHIEEQELTQAFT 127
            ....|:|..|.:|::|||...||.||::.|..|:.:|.||..:|:.||:|.||.|.:.||.||..
 Frog   146 NWSSFNDETCMMMMNMFDKSNSGRIDLFGFSALWRFIQQWRNLFQQYDRDRSGSINQGELHQALC 210

  Fly   128 QMGFRFSPEFINFLV----KKSDPQGHKEVSVDQFIVLCVQVQRFTEAFRQRDTQQNGTITIGFE 188
            |||::.||:|:..::    ::|...|   :.:|:||.:|.|:|..|:|||::||..:|...:.:|
 Frog   211 QMGYQLSPQFVQLVMSRYAQRSVQPG---LQLDRFIQICTQLQSMTQAFREKDTGLSGNAKLSYE 272

  Fly   189 DFLTV 193
            ||||:
 Frog   273 DFLTM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17765NP_610592.1 FRQ1 26..162 CDD:227455 56/139 (40%)
EFh 39..92 CDD:238008 24/52 (46%)
EFh 105..159 CDD:298682 20/57 (35%)
pef1XP_002938526.1 EFh_PEF_peflin 117..282 CDD:320059 68/163 (42%)
EF-hand motif 117..146 CDD:320059 15/28 (54%)
EF-hand motif 154..183 CDD:320059 11/28 (39%)
EF-hand motif 184..214 CDD:320059 15/29 (52%)
EF-hand motif 220..250 CDD:320059 8/32 (25%)
EF-hand motif 251..282 CDD:320059 12/26 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I10651
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56569
Inparanoid 1 1.050 153 1.000 Inparanoid score I4238
OMA 1 1.010 - - QHG54126
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0000697
OrthoInspector 1 1.000 - - oto102567
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2225
SonicParanoid 1 1.000 - - X1327
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.