DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trsn and tsn

DIOPT Version :9

Sequence 1:NP_610591.1 Gene:trsn / 36110 FlyBaseID:FBgn0033528 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001007517.1 Gene:tsn / 493243 XenbaseID:XB-GENE-970319 Length:228 Species:Xenopus tropicalis


Alignment Length:229 Identity:119/229 - (51%)
Similarity:154/229 - (67%) Gaps:9/229 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIHSD--LSQISAACGLARKQVELC 69
            :|:|...|..:..:|:|||.||.||:.:|..::|..|.||.:|.:  ...|.|.|.|||:.....
 Frog     4 IDMFVQLQNGLSADQDVREEIRKVVQSLEQTAREILILLQGVHQEAGFKDIPAKCLLAREHYGTV 68

  Fly    70 AQKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGF 134
            ..:...|....|..|||::.|.|.|:.|||:|:.:.::|||:..|||||..||:||:...:.:||
 Frog    69 RAQLAALQTKFPTEQYYKFHDQWRFVLQRLVFLASFLVYLESETLVTREAAAEILGIAYEREKGF 133

  Fly   135 HLDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDAL 199
            |||:||||.|:|.||:||||.|.|||..|||.|||.|:.||.:|:.||||||||||.||||:|.|
 Frog   134 HLDIEDYLSGVLNLANELSRLAVNSVIAGDYSRPLRIASFINELDFGFRLLNLKNDSLRKRYDGL 198

  Fly   200 KYDVKKIEEVVYDVSIRGLSSKEKDQQEEPAVPA 233
            |||||||||||||:||||||      :|||| ||
 Frog   199 KYDVKKIEEVVYDLSIRGLS------KEEPA-PA 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trsnNP_610591.1 Translin 13..217 CDD:271349 107/205 (52%)
tsnNP_001007517.1 Translin 10..216 CDD:271349 107/205 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2750
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3397
Inparanoid 1 1.050 225 1.000 Inparanoid score I3415
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187354at2759
OrthoFinder 1 1.000 - - FOG0006024
OrthoInspector 1 1.000 - - oto104109
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4320
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.