DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment trsn and Tsn

DIOPT Version :9

Sequence 1:NP_610591.1 Gene:trsn / 36110 FlyBaseID:FBgn0033528 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_035780.1 Gene:Tsn / 22099 MGIID:109263 Length:228 Species:Mus musculus


Alignment Length:216 Identity:114/216 - (52%)
Similarity:148/216 - (68%) Gaps:2/216 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DIFSNYQKYIDNEQEVRENIRIVVREIEHLSKEAQIKLQIIH--SDLSQISAACGLARKQVELCA 70
            :||...|.::..||::||.||.||:.:|..::|....||.:|  :....|...|..||:......
Mouse     5 EIFVELQGFLAAEQDIREEIRKVVQSLEQTAREILTLLQGVHQGTGFQDIPKRCLKAREHFSTVK 69

  Fly    71 QKYQKLAELVPAGQYYRYSDHWTFITQRLIFIIALVIYLEAGFLVTRETVAEMLGLKISQSEGFH 135
            .....|....||.||||:.:||.|:.|||:|:.|.|:|||...|||||.|.|:||::..:.:|||
Mouse    70 THLTSLKTKFPAEQYYRFHEHWRFVLQRLVFLAAFVVYLETETLVTREAVTEILGIEPDREKGFH 134

  Fly   136 LDVEDYLLGILQLASELSRFATNSVTMGDYERPLNISHFIGDLNTGFRLLNLKNDGLRKRFDALK 200
            |||||||.|:|.|||||||.:.||||.|||.|||:||.||.:|::||||||||||.||||:|.||
Mouse   135 LDVEDYLSGVLILASELSRLSVNSVTAGDYSRPLHISTFINELDSGFRLLNLKNDSLRKRYDGLK 199

  Fly   201 YDVKKIEEVVYDVSIRGLSSK 221
            |||||:||||||:||||.:.:
Mouse   200 YDVKKVEEVVYDLSIRGFNKE 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
trsnNP_610591.1 Translin 13..217 CDD:271349 110/205 (54%)
TsnNP_035780.1 Translin 10..216 CDD:271349 110/205 (54%)
DNA/RNA binding 86..90 1/3 (33%)
Leucine-zipper. /evidence=ECO:0000255 177..198 16/20 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831328
Domainoid 1 1.000 213 1.000 Domainoid score I2757
eggNOG 1 0.900 - - E1_KOG3067
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3397
Inparanoid 1 1.050 223 1.000 Inparanoid score I3507
Isobase 1 0.950 - 0 Normalized mean entropy S5582
OMA 1 1.010 - - QHG55801
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006024
OrthoInspector 1 1.000 - - oto93886
orthoMCL 1 0.900 - - OOG6_104779
Panther 1 1.100 - - LDO PTHR10741
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1560
SonicParanoid 1 1.000 - - X4320
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.740

Return to query results.
Submit another query.