DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment whd and CRAT

DIOPT Version :9

Sequence 1:NP_001163111.1 Gene:whd / 36109 FlyBaseID:FBgn0261862 Length:782 Species:Drosophila melanogaster
Sequence 2:NP_001287195.1 Gene:CRAT / 40787 FlyBaseID:FBgn0037440 Length:662 Species:Drosophila melanogaster


Alignment Length:651 Identity:207/651 - (31%)
Similarity:324/651 - (49%) Gaps:64/651 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LPTMLWVAVVRVLSSWNKPGLYSFQGSLPRLPLPSVKDTMTRYLRSVRPLLDDENYTRMERLAKE 208
            ||...:..|.:.: ...:|.|..:.    .|||   ::|:.|::.:|.|||..|.:.|.:.:..|
  Fly    55 LPASSYSTVQKTI-PLEQPNLLKYH----VLPL---EETLNRFMTTVEPLLTPEEFQRQKGITSE 111

  Fly   209 FEQTIGKKLQWYLILKSWWS--TNYVSDWWEEYVYLRGRSPLCVNSNFYGTDAIF--MNLTDKQA 269
            |.:..|::||  |:|:...|  .|:::..|.:..||..|.|:.|   |......|  .|..|.:|
  Fly   112 FLKKQGRELQ--LLLEETGSKEKNWLAHRWLKAAYLTYRDPVTV---FVSPGMTFPKQNFRDSRA 171

  Fly   270 --ARAANVISLLLNFRRLIEHQELQPIMVQGMIPLCSWQYERTFNTARVPGLETDRIIHYRDSNH 332
              ...|.||..|..|..:: |....||:..|...|.:.|:.:.|.|.|:|...||.|::..||::
  Fly   172 FVDYTARVIYGLGEFNDMV-HANKIPIVKMGKNELDNSQFGKVFGTCRIPRRGTDEIVYNPDSDY 235

  Fly   333 IVVLHKGCYYKMLIYYK-GRIL-RPCELQVQIEEILKGKATPVEGEEHLAALTAWNRSKWAEARN 395
            :||::|..:|::.||.| |::: .|| |..|:|.|:. |.|.| |..: ..||..:|..||||..
  Fly   236 VVVIYKNHFYQLKIYSKEGKLIAAPC-LAAQLENIVL-KETQV-GVPY-GILTTDSRDNWAEAYE 296

  Fly   396 TFFSWGVNQTSLRTIESAAFVLSLDDEPFEFDLARPELLDNFGKKLLHGNGY-----NRWFDKCF 455
            .......|:.:|:||:.|.|.:|||:...   |...|..|.....|:||:|.     |||.||..
  Fly   297 YLVETPGNRDALKTIQGALFTVSLDEGTI---LKEGEETDELILSLIHGSGSKINSGNRWMDKTI 358

  Fly   456 TVCVGTNGRVGFNAEHTWSDAAIASHMWENLIVDDLVSDGYDETGNTKGTPAFQPPTPTRLTWDL 520
            .:.|..||.|||..||:.::....:.|.: .:|..:..   |.:....|:..|.|....:.:...
  Fly   359 QLVVNPNGNVGFTYEHSPAEGQPIAMMMD-YVVQKMKE---DPSFGQSGSQDFAPAQKIQFSSSN 419

  Fly   521 KPCLAQIEEATIDVTKLINEVNLRILVHQDYGKGFMKKCRISPDAYIQMALQLAYYRDAGRFSLT 585
            |.....:..|..:|.||.:.:.:::|....:||.|:||.|:.||:::|||||||:|:........
  Fly   420 KSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQ 484

  Fly   586 YEASMTRLFREGRTETVRPCTIESSAWVKAMQNPNTTNDERVKMMQAACDRHQLGYQDAMCGRGI 650
            ||::..|:|..|||||:|.|:.||.|:.:|||:||.|:.||...::.|...||...:.|:.|:|:
  Fly   485 YESAHLRIFDGGRTETIRSCSNESLAFSRAMQDPNVTDQERAAKLREAVVSHQTYAKLALQGKGV 549

  Fly   651 DRHLFCLYVVSKYLEVDSP---FLNE---VLSEPWRLSTSQTPHGQTPKMDLKKHPNCISAGGGF 709
            ||||..|.:::  ||...|   |...   |.|..:|:||||.    ..|.|         |..|:
  Fly   550 DRHLLGLKLMA--LEHSKPIPEFFKSPGFVKSSHFRMSTSQV----ATKYD---------AFMGY 599

  Fly   710 GPVADDGYGVSYIIAGENLIFFHISAKTTCQQTDVHRFAQNISQALSDIRSMFEQHMKDHPKPAK 774
            ||..||||...| ...:|.|...|||...|..||..:|.:.:.|:..:::::.|:    :|...|
  Fly   600 GPATDDGYACCY-NPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEK----NPPETK 659

  Fly   775 S 775
            |
  Fly   660 S 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
whdNP_001163111.1 CPT_N 1..45 CDD:293093
Carn_acyltransf 171..759 CDD:279140 198/606 (33%)
CRATNP_001287195.1 Carn_acyltransf 74..648 CDD:279140 199/613 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448726
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D35481at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46717
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22589
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.