DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CPR2

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_011924.1 Gene:CPR2 / 856454 SGDID:S000001099 Length:205 Species:Saccharomyces cerevisiae


Alignment Length:158 Identity:61/158 - (38%)
Similarity:84/158 - (53%) Gaps:18/158 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASDY----YSGCVFIRNIKGFIVQTGDPTN-TGKNGQSIWG 68
            ||.:.|.|:...|||..:||..|..:..    :.|..|.|.|..|:||.||.|: ||..|:||:|
Yeast    49 VGRIVIGLYGKVCPKTAKNFYKLSTTTNSKKGFIGSTFHRVIPNFMVQGGDFTDGTGVGGKSIYG 113

  Fly    69 QKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPN-LDLKYTLFGRVIDGFDALDELE 132
            ..|.|| ..|:||..:|.:||||.|.:.|.||||||...:.: ||.|:.:||:|:||.|.:    
Yeast   114 DTFPDE-NFTLKHDRKGRLSMANRGKDTNGSQFFITTTEEASWLDGKHVVFGQVVDGMDVV---- 173

  Fly   133 KLPVNPKNYRPHVDKKINGVTIHANPLA 160
                   ||..||.:..|...:.|..:|
Yeast   174 -------NYIQHVSRDANDKPLEAVKIA 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 59/150 (39%)
CPR2NP_011924.1 cyclophilin 37..197 CDD:412213 61/158 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.