DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and PPIL4

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_624311.1 Gene:PPIL4 / 85313 HGNCID:15702 Length:492 Species:Homo sapiens


Alignment Length:167 Identity:70/167 - (41%)
Similarity:104/167 - (62%) Gaps:11/167 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNI-KGFIVQTGDPTNTGKNGQ 64
            |:|.|.|.:||:.|:|:.:..|:||.|||.||...||:.|: |.|: :.||:||||||.||:.|:
Human     1 MAVLLETTLGDVVIDLYTEERPRACLNFLKLCKIKYYNYCL-IHNVQRDFIIQTGDPTGTGRGGE 64

  Fly    65 SIWGQKFDDE--FKET-----IKHTDRGMVSMANNGPNANASQFFITYAAQPN-LDLKYTLFGRV 121
            ||:||.:.|:  |.|.     |||..:|.|||.|||.:.:.|||.||.....: ||..:|:||.|
Human    65 SIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFLITTGENLDYLDGVHTVFGEV 129

  Fly   122 IDGFDALDELEKLPVNPKNYRPHVDKKINGVTIHANP 158
            .:|.|.:.::.:..|: |::.|:.|.:||...|..:|
Human   130 TEGMDIIKKINETFVD-KDFVPYQDIRINHTVILDDP 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 68/161 (42%)
PPIL4NP_624311.1 cyclophilin_RRM 4..161 CDD:238902 66/158 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..188
RRM_PPIL4 237..319 CDD:240681
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 368..406
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 423..492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.