DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CPR5

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_010590.3 Gene:CPR5 / 851898 SGDID:S000002712 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:142 Identity:55/142 - (38%)
Similarity:77/142 - (54%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HTD--VGDLKIELFCDACPKACENFLALCASD----YYSGCVFIRNIKGFIVQTGDPTN-TGKNG 63
            |.|  :|.:.:.|:....|:..|||..|..|.    .|...:|.|.|..|::|.||.|: :|..|
Yeast    42 HGDKQIGRIVMGLYGLTTPQTVENFYQLTISRDPKMGYLNSIFHRVIPNFMIQGGDFTHRSGIGG 106

  Fly    64 QSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDAL 128
            :||:|..|.|| ...:||...|.:||||.|.|.|.||||||....|.||.|:.:||.|:||.|.:
Yeast   107 KSIFGNTFKDE-NFDVKHDKPGRLSMANRGKNTNGSQFFITTVPCPWLDGKHVVFGEVLDGMDVV 170

  Fly   129 DELEKLPVNPKN 140
            ..:|.:..:.:|
Yeast   171 HYIENVKTDSRN 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 55/142 (39%)
CPR5NP_010590.3 cyclophilin 34..194 CDD:412213 55/142 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.