DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CPR6

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_013317.1 Gene:CPR6 / 850914 SGDID:S000004206 Length:371 Species:Saccharomyces cerevisiae


Alignment Length:154 Identity:63/154 - (40%)
Similarity:84/154 - (54%) Gaps:14/154 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLKIELFCDACPKACENFLALCASD------------YYSGCVFIRNIKGFIVQTGDPTN-TGK 61
            |.:..||:.|..||..||||.||..:            .|.|.:|.|.||.|:.|.||.|| .|.
Yeast    18 GRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGSIFHRVIKDFMCQFGDFTNFNGT 82

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126
            .|:||:.:||:|| ..|:||....::||||.|||.|.||.|||....|:||.|:.:||.||.|..
Yeast    83 GGESIYDEKFEDE-NFTVKHDKPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKR 146

  Fly   127 ALDELEKLPVNPKNYRPHVDKKIN 150
            .:..:|....:.:|.:|..|.||:
Yeast   147 IVRLIENQQCDQENNKPLRDVKID 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 63/154 (41%)
CPR6NP_013317.1 cyclophilin_ABH_like 4..173 CDD:238907 63/154 (41%)
TPR repeat 219..264 CDD:276809
TPR repeat 269..303 CDD:276809
TPR repeat 308..334 CDD:276809
TPR_1 311..341 CDD:395414
TPR repeat 342..368 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.