DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and AT4G33060

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_195032.2 Gene:AT4G33060 / 829443 AraportID:AT4G33060 Length:504 Species:Arabidopsis thaliana


Alignment Length:167 Identity:63/167 - (37%)
Similarity:91/167 - (54%) Gaps:20/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.::|..|.:.:||:....||:..||:.||...|:...:|.|.|.||:||.||||.:|..|.||:
plant    15 VIVNTTHGPIDVELWPKEAPKSVRNFVQLCLEGYFDNTIFHRVIPGFLVQGGDPTGSGTGGDSIY 79

  Fly    68 GQKFDDEFKETIKHTDRGMVSMAN-NGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDEL 131
            |..|.|||...::.:.||:|:||| :.||:|.||||.|......||.|:|:||:|..  |::..|
plant    80 GGVFADEFHSRLRFSHRGIVAMANASSPNSNGSQFFFTLDKCDWLDKKHTIFGKVTG--DSIYNL 142

  Fly   132 EKL----------PVNPKNYRPHVDKKINGVTIHANP 158
            .:|          |::|.       .||..|.:..||
plant   143 LRLGEVDTSKDDRPLDPA-------PKILSVEVLWNP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 61/161 (38%)
AT4G33060NP_195032.2 cyclophilin_CeCYP16-like 8..180 CDD:238906 63/167 (38%)
PTZ00121 <248..>497 CDD:173412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.