DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppil2

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001039036.2 Gene:ppil2 / 733789 XenbaseID:XB-GENE-855860 Length:521 Species:Xenopus tropicalis


Alignment Length:156 Identity:78/156 - (50%)
Similarity:105/156 - (67%) Gaps:0/156 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSIW 67
            |.|||:.|||.:||:||..||.||||:.||..:||.|.:|.|:|:.|::|.||||.||..|:|.|
 Frog   282 VRLHTNKGDLNLELYCDKTPKTCENFVKLCKKNYYDGTIFHRSIRNFVIQGGDPTGTGTGGESFW 346

  Fly    68 GQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            |:.|.||.|..:.||.||::||||.|||.|.||||||:.:...||.|:|:||||:.|||.|..:|
 Frog   347 GKPFKDELKPNLSHTGRGVLSMANTGPNTNKSQFFITFRSCTYLDRKHTVFGRVVGGFDTLTAME 411

  Fly   133 KLPVNPKNYRPHVDKKINGVTIHANP 158
            .:..:.|..||..:.:|...|:..:|
 Frog   412 NVDTDTKTDRPKEEIRIESSTVFVDP 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 76/150 (51%)
ppil2NP_001039036.2 RING-Ubox_PPIL2 39..110 CDD:319577
U-box domain, a modified RING finger 42..79 CDD:319577
RING_Ubox 100..159 CDD:388418
cyclophilin_RING 281..440 CDD:238904 78/156 (50%)
Selenoprotein_S <439..>506 CDD:369143
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.