DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppil3

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_011236892.1 Gene:Ppil3 / 70225 MGIID:1917475 Length:176 Species:Mus musculus


Alignment Length:122 Identity:88/122 - (72%)
Similarity:106/122 - (86%) Gaps:0/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65
            |||||||||||:|||:||:..||.||||||||||:||:||||.||||||:|||||||.||:.|.|
Mouse     1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSS 65

  Fly    66 IWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVI 122
            ||.:||:||:.|.:||..||:|||||||||.|.|||||||..||:||:|||:||:::
Mouse    66 IWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKLL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 88/122 (72%)
Ppil3XP_011236892.1 Cyclophilin_PPIL3_like 1..>122 CDD:238909 88/120 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 235 1.000 Domainoid score I2373
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 252 1.000 Inparanoid score I3200
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54802
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto93179
orthoMCL 1 0.900 - - OOG6_102733
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.860

Return to query results.
Submit another query.