DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppil1

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_081121.1 Gene:Ppil1 / 68816 MGIID:1916066 Length:166 Species:Mus musculus


Alignment Length:148 Identity:64/148 - (43%)
Similarity:92/148 - (62%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSI 66
            :|.|.|.:|.:.:||:....||.|:||..|....||:|..|.|.||.|::|.||||.||:.|.||
Mouse    13 NVYLETSMGVIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI 77

  Fly    67 WGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDEL 131
            :|::|:||....:|.|..|:::|||.||:.|.||||:|.|....||.|:|:||||..|...::.:
Mouse    78 YGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRV 142

  Fly   132 EKLPVNPKNYRPHVDKKI 149
            ..:..|.:: ||..|.||
Mouse   143 GMVETNSQD-RPVDDVKI 159

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/148 (43%)
Ppil1NP_081121.1 cyclophilin_SpCYP2_like 15..161 CDD:238903 63/146 (43%)
Cyclosporin A binding. /evidence=ECO:0000250 54..65 5/10 (50%)