DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppil6

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:XP_017457315.1 Gene:Ppil6 / 685567 RGDID:1592581 Length:332 Species:Rattus norvegicus


Alignment Length:175 Identity:59/175 - (33%)
Similarity:83/175 - (47%) Gaps:33/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD----------YYSGCVFIRNIKGFIVQTGD-PTNTGKN 62
            :|.|..||:|||||:.|.||..||...          :|...:|.|.:|...||.|| ....|.:
  Rat   157 IGRLIFELYCDACPRTCTNFQVLCTGTSGFSERGIKLHYKDSIFHRVVKNGWVQGGDIVEGRGDD 221

  Fly    63 GQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDA 127
            |:||:|..|:|| ..::.|..||::.|.|.|.:.|.|||:||..|.|.||.||..||        
  Rat   222 GESIYGPTFEDE-NFSVPHNKRGVLGMVNKGHHTNGSQFYITLQATPYLDKKYVAFG-------- 277

  Fly   128 LDELEKLPVNPKNYRPH------VDKKINGVTI-------HANPL 159
            |..:..:|....:..||      :.:.::|..|       |:|.|
  Rat   278 LHSILYMPHLHDDIIPHSGTYVNIREAVSGSCISWTLYSAHSNSL 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 55/161 (34%)
Ppil6XP_017457315.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.