DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and Ppid

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_080628.1 Gene:Ppid / 67738 MGIID:1914988 Length:370 Species:Mus musculus


Alignment Length:141 Identity:64/141 - (45%)
Similarity:83/141 - (58%) Gaps:13/141 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD-----------YYSGCVFIRNIKGFIVQTGDPTN-TGK 61
            ||.:.:|||.|..||..|||.|||..:           ::.||.|.|.||.|::|.||.:| .|.
Mouse    29 VGRIVLELFADIVPKTAENFRALCTGEKGTGSTTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGT 93

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126
            .|:||:|:||:|| ....||...|::||||.|||.|.||||||....|:||.|:.:||:||.|..
Mouse    94 GGESIYGEKFEDE-NFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVIKGLG 157

  Fly   127 ALDELEKLPVN 137
            ....||.:.||
Mouse   158 VARTLENVEVN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/141 (45%)
PpidNP_080628.1 cyclophilin_ABH_like 16..182 CDD:238907 64/141 (45%)
Chaperone activity. /evidence=ECO:0000250 185..215
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR_11 223..304 CDD:290150
TPR repeat 223..251 CDD:276809
TPR repeat 272..302 CDD:276809
TPR_11 277..338 CDD:290150
TPR 277..306 CDD:197478
TPR repeat 307..335 CDD:276809
TPR_1 308..340 CDD:278916
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.