DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppil1

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001029350.1 Gene:ppil1 / 558042 ZFINID:ZDB-GENE-051009-1 Length:166 Species:Danio rerio


Alignment Length:153 Identity:66/153 - (43%)
Similarity:96/153 - (62%) Gaps:1/153 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSI 66
            :|:|.|.:|.:.:||:.:..||.|:||..|....||:...|.|.||.|:||.||||.||:.|.||
Zfish    13 TVSLDTTMGTIVLELYWNHAPKTCKNFAELGRRGYYNSTKFHRIIKDFMVQGGDPTGTGRGGASI 77

  Fly    67 WGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDEL 131
            :|::|:|||...:|.|..|:::|||.||:.|.||||::.|....||.|:|:||||..|...|:.:
Zfish    78 YGKQFEDEFHPELKFTGAGILAMANAGPDTNGSQFFLSLAPTQWLDGKHTIFGRVCQGIGVLNRI 142

  Fly   132 EKLPVNPKNYRPHVDKKINGVTI 154
            ..:..|.:: ||..|.||..|.:
Zfish   143 GMVETNSQD-RPVDDIKILRVNL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 66/151 (44%)
ppil1NP_001029350.1 cyclophilin 16..161 CDD:294131 64/145 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.