DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppil6

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001018433.1 Gene:ppil6 / 553623 ZFINID:ZDB-GENE-050522-70 Length:293 Species:Danio rerio


Alignment Length:153 Identity:64/153 - (41%)
Similarity:80/153 - (52%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASD----------YYSGCVFIRNIKGFIVQTGD--PTNTGK 61
            ||.|..|||.|.|||.|.||.|||..:          .|.|.||.|.:....:|.||  |...|.
Zfish   136 VGRLLFELFSDVCPKTCRNFKALCTGEAGLSKSNLELSYKGSVFHRVVPNGWIQGGDISPEKKGT 200

  Fly    62 NGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126
            .|:||:|..|:|| ...|.|..||::.|||.|.::|.|||:||......:|.||..||::.:|.|
Zfish   201 GGESIYGPTFEDE-NFVISHNKRGILGMANQGAHSNGSQFYITLQPATWMDQKYVAFGQLAEGTD 264

  Fly   127 ALDELEKLPVNPKNYRPHVDKKI 149
            .|..||.:|.  .|.||..|.||
Zfish   265 VLKRLEAVPT--YNERPKQDCKI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 64/153 (42%)
ppil6NP_001018433.1 cyclophilin 125..289 CDD:294131 64/153 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.