DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and PPIB

DIOPT Version :10

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_000933.1 Gene:PPIB / 5479 HGNCID:9255 Length:216 Species:Homo sapiens


Alignment Length:152 Identity:59/152 - (38%)
Similarity:83/152 - (54%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DVGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGDPT-NTGKNGQSIWG 68
            |||.:...||....||..:||:||...:.   |....|.|.||.|::|.||.| ..|..|:||:|
Human    56 DVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG 120

  Fly    69 QKFDDE-FKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            ::|.|| ||  :||...|.|||||.|.:.|.||||||......||.|:.:||:|::|.:.:.::|
Human   121 ERFPDENFK--LKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVE 183

  Fly   133 KLPVNPKNYRPHVDKKINGVTI 154
            ....:.:      ||.:..|.|
Human   184 STKTDSR------DKPLKDVII 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 58/150 (39%)
PPIBNP_000933.1 cyclophilin_ABH_like 45..203 CDD:238907 59/152 (39%)
Prevents secretion from ER 213..216
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.