DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and PPIL3

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_115861.1 Gene:PPIL3 / 53938 HGNCID:9262 Length:165 Species:Homo sapiens


Alignment Length:173 Identity:93/173 - (53%)
Similarity:112/173 - (64%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDP--------- 56
            |||||||||||:|||:||:..||.||         ..|.||....::...:.:..|         
Human     1 MSVTLHTDVGDIKIEVFCERTPKTCE---------MESRCVPQAGVQWRDLGSLQPPPPGFKQVF 56

  Fly    57 ----TNTGKNGQSIWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTL 117
                ..||:.|.||||:||:||:.|.:||..||:|||||||||.|.|||||||..||:||:|||:
Human    57 CLSLPRTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTV 121

  Fly   118 FGRVIDGFDALDELEKLPVNPKNYRPHVDKKINGVTIHANPLA 160
            ||:||||.:.||||||||||.|.|||..|..|..:||||||.|
Human   122 FGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 86/165 (52%)
PPIL3NP_115861.1 cyclophilin 1..158 CDD:294131 86/165 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 237 1.000 Domainoid score I2328
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 253 1.000 Inparanoid score I3214
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54802
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto89612
orthoMCL 1 0.900 - - OOG6_102733
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.