DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppil3

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001004983.1 Gene:ppil3 / 448435 XenbaseID:XB-GENE-957807 Length:161 Species:Xenopus tropicalis


Alignment Length:160 Identity:115/160 - (71%)
Similarity:138/160 - (86%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65
            ||||||||:|::||||||:..|||.|||||||||:||:||:|.||||||:|||||||.|||.|||
 Frog     1 MSVTLHTDLGEIKIELFCERAPKASENFLALCASNYYTGCLFHRNIKGFMVQTGDPTGTGKGGQS 65

  Fly    66 IWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDE 130
            |||:||:||:.|.:||:.||:|||||||||.|||||||||..||:||:|||:||:||||.|.|||
 Frog    66 IWGRKFEDEYSEFLKHSVRGVVSMANNGPNTNASQFFITYGKQPHLDMKYTVFGKVIDGLDTLDE 130

  Fly   131 LEKLPVNPKNYRPHVDKKINGVTIHANPLA 160
            ||||||:.|::||..:.:|...||||||.|
 Frog   131 LEKLPVHEKSFRPLTEVRIKDATIHANPFA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 108/152 (71%)
ppil3NP_001004983.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 108/152 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2298
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 252 1.000 Inparanoid score I3136
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto103434
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.