DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG5071

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001303432.1 Gene:CG5071 / 43090 FlyBaseID:FBgn0039347 Length:680 Species:Drosophila melanogaster


Alignment Length:133 Identity:37/133 - (27%)
Similarity:58/133 - (43%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 GDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGD-PTNTGKNGQSIWGQK 70
            |.:.||:..||.|:..:||.||...:.   |.||...:...|..:.||| .:..|:.|.|.:..:
  Fly   528 GRVLIEVRSDAAPRMADNFGALVRHERGYGYRGCTVFQAWGGESIITGDFESQNGRGGHSAFESR 592

  Fly    71 FDDEF--KETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDL----KYT-LFGRVIDGFDAL 128
            :   |  .||.....||.|.|.......:.|.|   ..:|..|.|    .:| :||.::.|.:.:
  Fly   593 Y---FLPDETGLPAHRGTVGMRRGQRRQDRSGF---VGSQFRLVLNEMRSFTAIFGFIVQGIELV 651

  Fly   129 DEL 131
            |.:
  Fly   652 DRI 654

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 37/133 (28%)
CG5071NP_001303432.1 RING 16..59 CDD:238093
cyclophilin 514..674 CDD:294131 37/133 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.