DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and ppil3

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001002146.1 Gene:ppil3 / 415236 ZFINID:ZDB-GENE-040625-159 Length:161 Species:Danio rerio


Alignment Length:160 Identity:113/160 - (70%)
Similarity:135/160 - (84%) Gaps:0/160 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVTLHTDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQS 65
            |:||||||:||:||||||:..||:|||||||||..:|:||:|.||||||||||||||.|||.|.|
Zfish     1 MAVTLHTDLGDMKIELFCEKAPKSCENFLALCAGGFYNGCIFHRNIKGFIVQTGDPTGTGKGGTS 65

  Fly    66 IWGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDE 130
            |||:||:|||.|.:||..||:|:|||||||.||||||.|||.||:||:|||:||::|||.:.|||
Zfish    66 IWGRKFEDEFSEHLKHNVRGVVAMANNGPNTNASQFFFTYAKQPHLDMKYTVFGKIIDGLETLDE 130

  Fly   131 LEKLPVNPKNYRPHVDKKINGVTIHANPLA 160
            :||||||.|.:||..|.:|..|||||||.|
Zfish   131 IEKLPVNEKTFRPLNDVRIKDVTIHANPFA 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 106/152 (70%)
ppil3NP_001002146.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 106/152 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581440
Domainoid 1 1.000 237 1.000 Domainoid score I2270
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41717
Inparanoid 1 1.050 252 1.000 Inparanoid score I3206
OMA 1 1.010 - - QHG54802
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 1 1.000 - - oto40130
orthoMCL 1 0.900 - - OOG6_102733
Panther 1 1.100 - - LDO PTHR45625
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R964
SonicParanoid 1 1.000 - - X3671
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.