DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11777 and CG7768

DIOPT Version :9

Sequence 1:NP_724939.1 Gene:CG11777 / 36108 FlyBaseID:FBgn0033527 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_648697.1 Gene:CG7768 / 39573 FlyBaseID:FBgn0036415 Length:164 Species:Drosophila melanogaster


Alignment Length:128 Identity:58/128 - (45%)
Similarity:76/128 - (59%) Gaps:5/128 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGDLKIELFCDACPKACENFLALCASDY---YSGCVFIRNIKGFIVQTGDPTN-TGKNGQSIWGQ 69
            :|.:.:||..|..||..|||.|||..:.   |.|..|.|.|..|:.|.||.|| .|..|:||:|.
  Fly    17 LGRIVMELRSDVVPKTAENFRALCTGEKGYGYKGSPFHRVIPNFMCQGGDFTNQNGTGGRSIYGN 81

  Fly    70 KFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFDALDELE 132
            ||.||..| :|||..|::||||.|.|.|.|||||.......||.|:.:||:|::|.|.:.::|
  Fly    82 KFPDENFE-LKHTGAGVLSMANAGANTNGSQFFICTGKTTWLDNKHVVFGKVVEGMDIVQKVE 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11777NP_724939.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 58/128 (45%)
CG7768NP_648697.1 cyclophilin_ABH_like 4..162 CDD:238907 58/128 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447214
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000032
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.790

Return to query results.
Submit another query.